PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.6R1JE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 242aa    MW: 27505.4 Da    PI: 7.0775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.6R1JEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-3296149255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Araip.6R1JE  96 PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 149
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-3092150IPR009057Homeodomain-like
PROSITE profilePS5129412.21892152IPR017930Myb domain
SuperFamilySSF466893.76E-1594150IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-2396151IPR006447Myb domain, plants
PfamPF002491.4E-997148IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MSKEYAGEII IEEDEETSSL GCCSQKCSSF DLNEEASSEE EEEGGGKNKK EEDEAACEEE  60
INANGRSNSR EDERNSNNKN NERRGGVRQY VRSKMPRLRW TPELHLSFVH AVERLGGQER  120
ATPKLVLQLM NVRGLSIAHV KSHLQMYRSK KLDETGQVLG QTYRSRQLHE VVGRSRNHHE  180
LLNPHQHFKM GNGGIILATN FNHHHHFQGS LMHHHHHPHF SLSSRSHAIA TDSGCNAMQA  240
VF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177659.11e-175PREDICTED: probable transcription factor KAN2
TrEMBLA0A151S6I72e-81A0A151S6I7_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA05G29161.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-38G2-like family protein